Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SORT1 Rabbit Polyclonal Antibody (HRP)

SORT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NT3, Gp95, NTR3, LDLCQ6

UniProt

Q99523

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002950

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPM1M Protein Vector (Human) (pPB-N-His)
PV032430 500 ng

PPM1M Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Anti-ITPA Antibody Picoband®, FITC Conjugate
A02304-FITC 100 µg/Vial

Anti-ITPA Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Trpm3 Mouse shRNA Lentiviral Particle (Locus ID 226025)
TL506716V 500 µL Each

Trpm3 Mouse shRNA Lentiviral Particle (Locus ID 226025)

Sign In for Pricing
View Details
Mouse PSCA Recombinant Protein (N-GST & C-His)
MT361012-01 50 µg

Mouse PSCA Recombinant Protein (N-GST & C-His)

Sign In for Pricing
View Details
Mouse PSCA Recombinant Protein (N-GST & C-His)
MT361012-02 100 µg

Mouse PSCA Recombinant Protein (N-GST & C-His)

Sign In for Pricing
View Details
Mouse PSCA Recombinant Protein (N-GST & C-His)
MT361012-03 1 mg

Mouse PSCA Recombinant Protein (N-GST & C-His)

Sign In for Pricing
View Details