Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLL1 Rabbit Polyclonal Antibody (HRP)

TLL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TLL, ASD6

UniProt

O43897

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TLL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

115kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036596

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-Off-hsa-miR-7975 Virus
mh7532 1.0 mL

AdmiRa-Off-hsa-miR-7975 Virus

Sign In for Pricing
View Details
CENPN (Centromere Protein N, CENP-N, Interphase Centromere Complex Protein 32, C16orf60, ICEN32, BM-309, BM039, FLJ13607, FLJ22660) (MaxLight 490)
MBS6373681-01 0.1 mL

CENPN (Centromere Protein N, CENP-N, Interphase Centromere Complex Protein 32, C16orf60, ICEN32, BM-309, BM039, FLJ13607, FLJ22660) (MaxLight 490)

Sign In for Pricing
View Details
CENPN (Centromere Protein N, CENP-N, Interphase Centromere Complex Protein 32, C16orf60, ICEN32, BM-309, BM039, FLJ13607, FLJ22660) (MaxLight 490)
MBS6373681-02 5x 0.1 mL

CENPN (Centromere Protein N, CENP-N, Interphase Centromere Complex Protein 32, C16orf60, ICEN32, BM-309, BM039, FLJ13607, FLJ22660) (MaxLight 490)

Sign In for Pricing
View Details
Phospho-RARA (Ser77) Antibody
CSB-PA554662 100 µL

Phospho-RARA (Ser77) Antibody

Sign In for Pricing
View Details
SYVN1 Blocking Peptide
33R-1484 100 ug

SYVN1 Blocking Peptide

Sign In for Pricing
View Details
Phosphoserine Aminotransferase (PSAT1) (NM_058179) Human Over-expression Lysate
E45H13391-2 20 µg

Phosphoserine Aminotransferase (PSAT1) (NM_058179) Human Over-expression Lysate

Sign In for Pricing
View Details