Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR35 Rabbit Polyclonal Antibody (HRP)

GPR35 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9HC97

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR35

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_001182310

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-4668-5p miRNA Mimic
CMH1479-01 5 nmol

Hsa-miR-4668-5p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-4668-5p miRNA Mimic
CMH1479-02 10 nmol

Hsa-miR-4668-5p miRNA Mimic

Sign In for Pricing
View Details
CC2D1A (Coiled-coil and C2 Domain-containing Protein 1A, MRT3, FREUD-1, Freud-1/Aki1) (Biotin)
MBS6409811-01 0.1 mL

CC2D1A (Coiled-coil and C2 Domain-containing Protein 1A, MRT3, FREUD-1, Freud-1/Aki1) (Biotin)

Sign In for Pricing
View Details
CC2D1A (Coiled-coil and C2 Domain-containing Protein 1A, MRT3, FREUD-1, Freud-1/Aki1) (Biotin)
MBS6409811-02 5x 0.1 mL

CC2D1A (Coiled-coil and C2 Domain-containing Protein 1A, MRT3, FREUD-1, Freud-1/Aki1) (Biotin)

Sign In for Pricing
View Details
RFP Stably Expressing REH Cell Line
T3947 1x106 cells / 1.0 mL

RFP Stably Expressing REH Cell Line

Sign In for Pricing
View Details
SYK Antibody
R34702-100UG 100 µg

SYK Antibody

Sign In for Pricing
View Details