Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cog1 Rabbit Polyclonal Antibody (FITC)

Cog1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ldlb, mKIAA1381, 6030445I15

UniProt

Q9Z160

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Cog1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ENQIKKEGAFPMTQNRALQLLYDLRYLTMVLSSKGEEVKSGRSKADSRME

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

109kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_038609

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protogenin (PRTG) Human ELISA Kit
G4810 96 Tests

Protogenin (PRTG) Human ELISA Kit

Sign In for Pricing
View Details
Farnesyltransferase, alpha subunit (FNTA) (PE) discontinued
F0019-58X1-PE 100 µL

Farnesyltransferase, alpha subunit (FNTA) (PE) discontinued

Sign In for Pricing
View Details
Mouse Rassf7 Pre-designed siRNA Set A
SI111727A 1 Each

Mouse Rassf7 Pre-designed siRNA Set A

Sign In for Pricing
View Details
PHOX2A (Paired Mesoderm Homeobox Protein 2A, ARIX1 Homeodomain Protein, Aristaless Homeobox Protein Homolog, Paired-like Homeobox 2A, ARIX, PMX2A) (MaxLight 750)
MBS6234494-01 0.1 mL

PHOX2A (Paired Mesoderm Homeobox Protein 2A, ARIX1 Homeodomain Protein, Aristaless Homeobox Protein Homolog, Paired-like Homeobox 2A, ARIX, PMX2A) (MaxLight 750)

Sign In for Pricing
View Details
PHOX2A (Paired Mesoderm Homeobox Protein 2A, ARIX1 Homeodomain Protein, Aristaless Homeobox Protein Homolog, Paired-like Homeobox 2A, ARIX, PMX2A) (MaxLight 750)
MBS6234494-02 5x 0.1 mL

PHOX2A (Paired Mesoderm Homeobox Protein 2A, ARIX1 Homeodomain Protein, Aristaless Homeobox Protein Homolog, Paired-like Homeobox 2A, ARIX, PMX2A) (MaxLight 750)

Sign In for Pricing
View Details
KCNA4 Antibody (C-term)
orb1931975-01 50 µL

KCNA4 Antibody (C-term)

Sign In for Pricing
View Details