Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cog1 Rabbit Polyclonal Antibody (HRP)

Cog1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ldlb, mKIAA1381, 6030445I15

UniProt

Q9Z160

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Cog1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ENQIKKEGAFPMTQNRALQLLYDLRYLTMVLSSKGEEVKSGRSKADSRME

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

109kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_038609

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PPAR alpha/NR1C1 Antibody (OTI1E8) [Dylight 594]
NBP2-73567DL594 0.1 mL

Mouse Monoclonal PPAR alpha/NR1C1 Antibody (OTI1E8) [Dylight 594]

Sign In for Pricing
View Details
MRPL18 Antibody - N-terminal region
MBS3218642-01 0.1 mL

MRPL18 Antibody - N-terminal region

Sign In for Pricing
View Details
MRPL18 Antibody - N-terminal region
MBS3218642-02 5x 0.1 mL

MRPL18 Antibody - N-terminal region

Sign In for Pricing
View Details
RETREG1 Rabbit Polyclonal Antibody
orb1676417 100 µg

RETREG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD13/ANPEP Mouse Monoclonal Antibody (Fluoro488)
orb3084824 100 µg

CD13/ANPEP Mouse Monoclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Recombinant Anabaena variabilis UPF0437 protein Ava_4254 (Ava_4254)
MBS1320575-01 0.02 mg (E-Coli)

Recombinant Anabaena variabilis UPF0437 protein Ava_4254 (Ava_4254)

Sign In for Pricing
View Details