Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNA3 Rabbit Polyclonal Antibody (Biotin)

CTNNA3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

VR22, ARVD13

UniProt

Q9UI47

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CTNNA3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PLIIQVTTLVNCPQNPSSRKKGRSKRASVLLASVEEATWNLLDKGEKIAQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal DYDC2 Antibody (009) [FITC]
NBP2-90257F 0.1 mL

Rabbit Monoclonal DYDC2 Antibody (009) [FITC]

Sign In for Pricing
View Details
Mouse Monoclonal Bax Antibody (SPM336) [mFluor Violet 500 SE]
NBP2-34763MFV500 0.1 mL

Mouse Monoclonal Bax Antibody (SPM336) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
PSMB4 CRISPRa sgRNA lentivector (set of three targets)(Human)
37960121 3x 1.0µg DNA

PSMB4 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
BOLL (Protein Boule-like, BOULE)
123980 100 µg

BOLL (Protein Boule-like, BOULE)

Sign In for Pricing
View Details
Recombinant Nitrosomonas europaea 1,4-alpha-glucan branching enzyme GlgB (glgB), partial
MBS1283545 Inquire

Recombinant Nitrosomonas europaea 1,4-alpha-glucan branching enzyme GlgB (glgB), partial

Sign In for Pricing
View Details
Csf1 (NM_023981) Rat Untagged Clone
RN212926 10 µg

Csf1 (NM_023981) Rat Untagged Clone

Sign In for Pricing
View Details