Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA1 Rabbit Polyclonal Antibody (Biotin)

LILRA1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LIR6, CD85I, LIR-6

UniProt

O75019

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human LILRA1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAY

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cox-2 Double Nickase Plasmid (h2)
sc-400072-NIC-2 20 µg

Cox-2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
EVI2B (Protein EVI2B, Ecotropic Viral Integration Site 2B Protein Homolog, EVI-2B, CD361, EVDB) (FITC)
126492-FITC 100 µL

EVI2B (Protein EVI2B, Ecotropic Viral Integration Site 2B Protein Homolog, EVI-2B, CD361, EVDB) (FITC)

Sign In for Pricing
View Details
Mouse N-acetyltransferase 14 (NAT14) ELISA Kit
abx534550 96 Tests

Mouse N-acetyltransferase 14 (NAT14) ELISA Kit

Sign In for Pricing
View Details
THOC4 (ALYREF, ALY, BEF, THOC4, THO complex subunit 4, Ally of AML-1 and LEF-1, Aly/REF export factor, Transcriptional coactivator Aly/REF, bZIP-enhancing factor BEF) (MaxLight 405)
MBS6402940-01 0.1 mL

THOC4 (ALYREF, ALY, BEF, THOC4, THO complex subunit 4, Ally of AML-1 and LEF-1, Aly/REF export factor, Transcriptional coactivator Aly/REF, bZIP-enhancing factor BEF) (MaxLight 405)

Sign In for Pricing
View Details
THOC4 (ALYREF, ALY, BEF, THOC4, THO complex subunit 4, Ally of AML-1 and LEF-1, Aly/REF export factor, Transcriptional coactivator Aly/REF, bZIP-enhancing factor BEF) (MaxLight 405)
MBS6402940-02 5x 0.1 mL

THOC4 (ALYREF, ALY, BEF, THOC4, THO complex subunit 4, Ally of AML-1 and LEF-1, Aly/REF export factor, Transcriptional coactivator Aly/REF, bZIP-enhancing factor BEF) (MaxLight 405)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) PAU7 Polyclonal Antibody
MBS7157494 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) PAU7 Polyclonal Antibody

Sign In for Pricing
View Details