Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA1 Rabbit Polyclonal Antibody (HRP)

LILRA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LIR6, CD85I, LIR-6

UniProt

O75019

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human LILRA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAY

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroglobulin (TG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D6]
TA803991BM 100 µL

Thyroglobulin (TG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D6]

Sign In for Pricing
View Details
OR2A25 (NM_001004488) Human Over-expression Lysate
LY423867 100 µg

OR2A25 (NM_001004488) Human Over-expression Lysate

Sign In for Pricing
View Details
MDS028 (ITFG2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI 3D8]
TA503045AM 100 µL

MDS028 (ITFG2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI 3D8]

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2445), CF640R conjugate, 0.1mg/mL
BNC402445-500 1x 500 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2445), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUV39H1 Human Gene Knockout Kit (CRISPR)
KN202428BN 1 Kit

SUV39H1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MBD3L2 Human Gene Knockout Kit (CRISPR)
KN421935 1 Kit

MBD3L2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details