Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPAR4 Rabbit Polyclonal Antibody (HRP)

LPAR4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LPA4, P2Y9, GPR23, P2RY9, P2Y5-LIKE

UniProt

Q99677

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005287

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS MERS Protein (293 cell line)
32-6273-5 5 µg

SARS MERS Protein (293 cell line)

Sign In for Pricing
View Details
Metabotropic Glutamate Receptor 8, CT (mGluR8, GPRC1H, MGLUR8, GRM8) (MaxLight 490) discontinued
M3884-83E-ML490 100 µL

Metabotropic Glutamate Receptor 8, CT (mGluR8, GPRC1H, MGLUR8, GRM8) (MaxLight 490) discontinued

Sign In for Pricing
View Details
PXK AAV Vector (Mouse) (CMV)
38236105 1 µg

PXK AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
HEPES Free Acid
40820000-6 5 kg

HEPES Free Acid

Sign In for Pricing
View Details
STMN2 AAV Vector (Human) (CMV)
45756101 1 µg

STMN2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
MS4A12 Mouse Monoclonal Antibody [Clone ID: LBI5F5]
AMM18133VCF 100 µg

MS4A12 Mouse Monoclonal Antibody [Clone ID: LBI5F5]

Sign In for Pricing
View Details