Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPAR4 Rabbit Polyclonal Antibody (FITC)

LPAR4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LPA4, P2Y9, GPR23, P2RY9, P2Y5-LIKE

UniProt

Q99677

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005287

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Galactosidase Beta GLb ELISA Kit
BG-HUM11045 1 Each

Human Galactosidase Beta GLb ELISA Kit

Sign In for Pricing
View Details
Omni Matrigel Special for Organoids (Low Growth Factors, Phenol Red - free)
OM760037-01 5 mL

Omni Matrigel Special for Organoids (Low Growth Factors, Phenol Red - free)

Sign In for Pricing
View Details
Omni Matrigel Special for Organoids (Low Growth Factors, Phenol Red - free)
OM760037-02 10 mL

Omni Matrigel Special for Organoids (Low Growth Factors, Phenol Red - free)

Sign In for Pricing
View Details
SIGLEC7-set siRNA/shRNA/RNAi Lentivector (Human)
43774091 4x 500 ng

SIGLEC7-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
ORF8 / ns8 Polyclonal Antibody
ANT-13602-100ug 100 µg

ORF8 / ns8 Polyclonal Antibody

Sign In for Pricing
View Details
LOC100362172 AAV Vector (Rat) (CMV)
26999106 1 µg

LOC100362172 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details