Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prepl Rabbit Polyclonal Antibody (HRP)

Prepl Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MKIAA0436, 2810457N15Rik, 9530014L06Rik, D030028O16Rik

UniProt

Q8C167

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Prepl

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRAVTLEAPFLDVLNTMLDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_666096

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFAIP1 (BTB/POZ Domain-Containing Adapter for CUL3-Mediated RhoA Degradation Protein 2, TNF Alpha Induced Protein 1)
494212 100 µL

TNFAIP1 (BTB/POZ Domain-Containing Adapter for CUL3-Mediated RhoA Degradation Protein 2, TNF Alpha Induced Protein 1)

Sign In for Pricing
View Details
Non-structural protein 8 Antibody
orb1239071-01 0.02 mg

Non-structural protein 8 Antibody

Sign In for Pricing
View Details
Non-structural protein 8 Antibody
orb1239071-02 0.1 mg

Non-structural protein 8 Antibody

Sign In for Pricing
View Details
KCNJ5 Rabbit Polyclonal Antibody (BF680)
orb2371743 100 µL

KCNJ5 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Lentiviral human LIPK sgRNA gene knockout kit - Lentiviral human LIPK sgRNA gene knockout kit (100)
GTR15389860 1 Vial

Lentiviral human LIPK sgRNA gene knockout kit - Lentiviral human LIPK sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
4-Fluoro-2-methoxybenzene-1-sulfonyl chloride
PYB37719-01 100 mg

4-Fluoro-2-methoxybenzene-1-sulfonyl chloride

Sign In for Pricing
View Details