Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMPD3 Rabbit Polyclonal Antibody (HRP)

AMPD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

B7Z2S2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRMAFRYETLCNELS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001165902

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QPCT ORF Vector (Human) (pORF)
ORF008462 1.0 µg DNA

QPCT ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Fibrinogen, Human (Coagulation Factor I)
F4203-02H 25 mg

Fibrinogen, Human (Coagulation Factor I)

Sign In for Pricing
View Details
Albumin, Equine Serum (Equ c 3, ALB) (HRP)
028990 100 µg

Albumin, Equine Serum (Equ c 3, ALB) (HRP)

Sign In for Pricing
View Details
Human Interleukin 1 Receptor Accessory Protein (IL1RAP) ELISA Kit
MBS160152-01 48 Well

Human Interleukin 1 Receptor Accessory Protein (IL1RAP) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 1 Receptor Accessory Protein (IL1RAP) ELISA Kit
MBS160152-02 96 Well

Human Interleukin 1 Receptor Accessory Protein (IL1RAP) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 1 Receptor Accessory Protein (IL1RAP) ELISA Kit
MBS160152-03 5x 96 Well

Human Interleukin 1 Receptor Accessory Protein (IL1RAP) ELISA Kit

Sign In for Pricing
View Details