Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDO2 Rabbit Polyclonal Antibody (HRP)

IDO2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

INDOL1

UniProt

F5H5G0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YRPWMEIANKLPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSF

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_919270

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Escherichia coli (ATCC® derived CultiControl)
89163 1 Vial

Escherichia coli (ATCC® derived CultiControl)

Sign In for Pricing
View Details
Pex11a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3113907 1.0 µg DNA

Pex11a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Human Pyruvate Kinase (PKLR) (NM_000298) AAV Particle
RC206455A1V 250 µL

Human Pyruvate Kinase (PKLR) (NM_000298) AAV Particle

Sign In for Pricing
View Details
Lentiviral mouse Crkl shRNA (UAS) - Lentiviral mouse Crkl shRNA (UAS) (100)
GTR15141090 1 Vial

Lentiviral mouse Crkl shRNA (UAS) - Lentiviral mouse Crkl shRNA (UAS) (100)

Sign In for Pricing
View Details
Anti Human CD33 Flow Cytometry Monoclonal Clone 6C5 PE/Cyanine7 Ready To Use 200 Tests
IMSAHUCD336C5CPECY7200 200 Tests

Anti Human CD33 Flow Cytometry Monoclonal Clone 6C5 PE/Cyanine7 Ready To Use 200 Tests

Sign In for Pricing
View Details
C15orf44 Protein Vector (Human) (pPM-N-D-C-His)
PV329013 500 ng

C15orf44 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details