Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDO2 Rabbit Polyclonal Antibody (HRP)

IDO2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

INDOL1

UniProt

F5H5G0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YRPWMEIANKLPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSF

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_919270

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine ATP-binding cassette sub-family A member 13 (ABCA13) ELISA Kit
MBS7209630-01 48 Well

Canine ATP-binding cassette sub-family A member 13 (ABCA13) ELISA Kit

Sign In for Pricing
View Details
Canine ATP-binding cassette sub-family A member 13 (ABCA13) ELISA Kit
MBS7209630-02 96 Well

Canine ATP-binding cassette sub-family A member 13 (ABCA13) ELISA Kit

Sign In for Pricing
View Details
Canine ATP-binding cassette sub-family A member 13 (ABCA13) ELISA Kit
MBS7209630-03 5x 96 Well

Canine ATP-binding cassette sub-family A member 13 (ABCA13) ELISA Kit

Sign In for Pricing
View Details
Canine ATP-binding cassette sub-family A member 13 (ABCA13) ELISA Kit
MBS7209630-04 10x 96 Well

Canine ATP-binding cassette sub-family A member 13 (ABCA13) ELISA Kit

Sign In for Pricing
View Details
Rat Monoclonal Autoimmune Regulator/AIRE Antibody (609930) [Janelia Fluor 635]
FAB6184JF635 0.1 mL

Rat Monoclonal Autoimmune Regulator/AIRE Antibody (609930) [Janelia Fluor 635]

Sign In for Pricing
View Details
Olfr620 3'UTR GFP Stable Cell Line
TU165368 1.0 mL

Olfr620 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details