Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP3CC Rabbit Polyclonal Antibody (HRP)

PPP3CC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CNA3, CALNA3, PP2Bgamma

UniProt

G3V111

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FTEPPAFGPVCDLLWSDPSEDYGNEKTLEHYTHNTVRGCSYFYSYPAVCE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

EAW63678

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPAN6, CT (TSPAN6, TM4SF6, Tetraspanin-6, A15 homolog, Putative NF-kappa-B-activating protein 321, T245 protein, Tetraspanin TM4-D, Transmembrane 4 superfamily member 6) (FITC) discontinued
043382-FITC 200 µL

TSPAN6, CT (TSPAN6, TM4SF6, Tetraspanin-6, A15 homolog, Putative NF-kappa-B-activating protein 321, T245 protein, Tetraspanin TM4-D, Transmembrane 4 superfamily member 6) (FITC) discontinued

Sign In for Pricing
View Details
Hace1 Mouse Gene Knockout Kit (CRISPR)
KN507549 1 Kit

Hace1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Rat Pyrroline-5-carboxylate reductase 3 (Pycrl)
MBS1384655-01 0.02 mg (E-Coli)

Recombinant Rat Pyrroline-5-carboxylate reductase 3 (Pycrl)

Sign In for Pricing
View Details
Recombinant Rat Pyrroline-5-carboxylate reductase 3 (Pycrl)
MBS1384655-02 0.02 mg (Yeast)

Recombinant Rat Pyrroline-5-carboxylate reductase 3 (Pycrl)

Sign In for Pricing
View Details
Recombinant Rat Pyrroline-5-carboxylate reductase 3 (Pycrl)
MBS1384655-03 0.1 mg (E-Coli)

Recombinant Rat Pyrroline-5-carboxylate reductase 3 (Pycrl)

Sign In for Pricing
View Details
Recombinant Rat Pyrroline-5-carboxylate reductase 3 (Pycrl)
MBS1384655-04 0.1 mg (Yeast)

Recombinant Rat Pyrroline-5-carboxylate reductase 3 (Pycrl)

Sign In for Pricing
View Details