Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP8B Rabbit Polyclonal Antibody (HRP)

BMP8B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OP2, BMP8

UniProt

P34820

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BMP8B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VRPLRRRQPKKTNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001711.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIIAD1 (NM_001144956) Human Tagged ORF Clone
RG227587 10 µg

RIIAD1 (NM_001144956) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Influenza A virus A/Hong Kong/4801/2014 X-263B (H3N2) Hemagglutinin Antigen (formaldehyde inactivated)
CW3-046 1 Vial

Recombinant Influenza A virus A/Hong Kong/4801/2014 X-263B (H3N2) Hemagglutinin Antigen (formaldehyde inactivated)

Sign In for Pricing
View Details
Plch1 ORF Vector (Rat) (pORF)
ORF073619 1.0 µg DNA

Plch1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Rat PI 3 Kinase Class 3 (PIK3C3, Vps34) ELISA Kit
MBS1600543-01 48 Well

Rat PI 3 Kinase Class 3 (PIK3C3, Vps34) ELISA Kit

Sign In for Pricing
View Details
Rat PI 3 Kinase Class 3 (PIK3C3, Vps34) ELISA Kit
MBS1600543-02 96 Well

Rat PI 3 Kinase Class 3 (PIK3C3, Vps34) ELISA Kit

Sign In for Pricing
View Details
Rat PI 3 Kinase Class 3 (PIK3C3, Vps34) ELISA Kit
MBS1600543-03 5x 96 Well

Rat PI 3 Kinase Class 3 (PIK3C3, Vps34) ELISA Kit

Sign In for Pricing
View Details