Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CABLES1 Rabbit Polyclonal Antibody (HRP)

CABLES1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CABL1, IK3-1, CABLES, HsT2563

UniProt

Q8TDN4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CABLES1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRKLCAGA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001094089

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B1 (Phospho-Ser126) Polyclonal Polyclonal Conjugated Antibody
C12193 100 µL

Cyclin B1 (Phospho-Ser126) Polyclonal Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
LPAAT-ε CRISPR Activation Plasmid (h2)
sc-412520-ACT-2 20 µg

LPAAT-ε CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Recombinant Human RhoG Protein
ARP3723-01 10 µg

Recombinant Human RhoG Protein

Sign In for Pricing
View Details
Recombinant Human RhoG Protein
ARP3723-02 50 µg

Recombinant Human RhoG Protein

Sign In for Pricing
View Details
Recombinant Human RhoG Protein
ARP3723-03 100 µg

Recombinant Human RhoG Protein

Sign In for Pricing
View Details
Recombinant Human RhoG Protein
ARP3723-04 1 mg

Recombinant Human RhoG Protein

Sign In for Pricing
View Details