Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CABLES1 Rabbit Polyclonal Antibody (Biotin)

CABLES1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CABL1, IK3-1, CABLES, HsT2563

UniProt

Q8TDN4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PSYMTTVIDYVKPSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_612384

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Dmgdh shRNA (UAS) - Lentiviral mouse Dmgdh shRNA (UAS, GFP) (100)
GTR15184497 1 Vial

Lentiviral mouse Dmgdh shRNA (UAS) - Lentiviral mouse Dmgdh shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
TEK (TEK Tyrosine Kinase, Endothelial, CD202B, TIE-2, TIE2, VMCM, VMCM1) (MaxLight 490)
MBS6208945-01 0.1 mL

TEK (TEK Tyrosine Kinase, Endothelial, CD202B, TIE-2, TIE2, VMCM, VMCM1) (MaxLight 490)

Sign In for Pricing
View Details
TEK (TEK Tyrosine Kinase, Endothelial, CD202B, TIE-2, TIE2, VMCM, VMCM1) (MaxLight 490)
MBS6208945-02 5x 0.1 mL

TEK (TEK Tyrosine Kinase, Endothelial, CD202B, TIE-2, TIE2, VMCM, VMCM1) (MaxLight 490)

Sign In for Pricing
View Details
Caspase 8 associated protein 2 (CASP8AP2) Rat ELISA Kit
C1702 96 Tests

Caspase 8 associated protein 2 (CASP8AP2) Rat ELISA Kit

Sign In for Pricing
View Details
Human protein phosphatase 1 regulatory subunit A, PPP1R1A ELISA Kit
CK-bio-13101-01 48 Tests

Human protein phosphatase 1 regulatory subunit A, PPP1R1A ELISA Kit

Sign In for Pricing
View Details
Human protein phosphatase 1 regulatory subunit A, PPP1R1A ELISA Kit
CK-bio-13101-02 96 Tests

Human protein phosphatase 1 regulatory subunit A, PPP1R1A ELISA Kit

Sign In for Pricing
View Details