Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL26 Rabbit Polyclonal Antibody (Biotin)

IL26 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AK155, IL-26

UniProt

Q9NPH9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IKAAWLKATIPEDRIKNIRLLKKKTKKQFMKNCQFQEQLLSFFMEDVFGQ

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060872

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1C2 Protein Vector (Human) (pPB-N-His)
PV003198 500 ng

ATP6V1C2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CLEC7A, NT (CLEC7A, BGR, CLECSF12, DECTIN1, C-type lectin domain family 7 member A, Beta-glucan receptor, C-type lectin superfamily member 12, Dendritic cell-associated C-type lectin 1) (FITC)
MBS6286726-01 0.2 mL

CLEC7A, NT (CLEC7A, BGR, CLECSF12, DECTIN1, C-type lectin domain family 7 member A, Beta-glucan receptor, C-type lectin superfamily member 12, Dendritic cell-associated C-type lectin 1) (FITC)

Sign In for Pricing
View Details
CLEC7A, NT (CLEC7A, BGR, CLECSF12, DECTIN1, C-type lectin domain family 7 member A, Beta-glucan receptor, C-type lectin superfamily member 12, Dendritic cell-associated C-type lectin 1) (FITC)
MBS6286726-02 5x 0.2 mL

CLEC7A, NT (CLEC7A, BGR, CLECSF12, DECTIN1, C-type lectin domain family 7 member A, Beta-glucan receptor, C-type lectin superfamily member 12, Dendritic cell-associated C-type lectin 1) (FITC)

Sign In for Pricing
View Details
SCFD1 (NM_001257376) Human Tagged ORF Clone
RG232959 10 µg

SCFD1 (NM_001257376) Human Tagged ORF Clone

Sign In for Pricing
View Details
PIAS3 Antibody (C-term)
orb30457-01 50 µL

PIAS3 Antibody (C-term)

Sign In for Pricing
View Details
PIAS3 Antibody (C-term)
orb30457-02 100 µL

PIAS3 Antibody (C-term)

Sign In for Pricing
View Details