Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL26 Rabbit Polyclonal Antibody (HRP)

IL26 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AK155, IL-26

UniProt

Q9NPH9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IKAAWLKATIPEDRIKNIRLLKKKTKKQFMKNCQFQEQLLSFFMEDVFGQ

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060872

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppef2 Mouse shRNA Plasmid (Locus ID 19023)
TL501714 1 Kit

Ppef2 Mouse shRNA Plasmid (Locus ID 19023)

Sign In for Pricing
View Details
Chicken Calmodulin-like protein 4 (CALML4) ELISA Kit
MBS7203049-01 48 Well

Chicken Calmodulin-like protein 4 (CALML4) ELISA Kit

Sign In for Pricing
View Details
Chicken Calmodulin-like protein 4 (CALML4) ELISA Kit
MBS7203049-02 96 Well

Chicken Calmodulin-like protein 4 (CALML4) ELISA Kit

Sign In for Pricing
View Details
Chicken Calmodulin-like protein 4 (CALML4) ELISA Kit
MBS7203049-03 5x 96 Well

Chicken Calmodulin-like protein 4 (CALML4) ELISA Kit

Sign In for Pricing
View Details
Chicken Calmodulin-like protein 4 (CALML4) ELISA Kit
MBS7203049-04 10x 96 Well

Chicken Calmodulin-like protein 4 (CALML4) ELISA Kit

Sign In for Pricing
View Details
SV2B (NM_014848) Human Over-expression Lysate
LC402380 20 µg

SV2B (NM_014848) Human Over-expression Lysate

Sign In for Pricing
View Details