Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JMY Rabbit Polyclonal Antibody (FITC)

JMY Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

WHAMM2, WHDC1L3

UniProt

Q8N9B5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VFIVAWNEIEGKFAITCHNRTAQRQRSGSREQAGARGGAEAGGAASDGSR

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_689618

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCC1-like G Exchanging Factor, NT (RCC1 And BTB Domain-containing Protein 2, Regulator Of Chromosome Condensation And BTB Domain-containing Protein 2, Chromosome Condensation 1-like, CHC1-L, CHC1L, RLG, RCBTB2) (MaxLight 405) discontinued
R1260-05-ML405 100 µL

RCC1-like G Exchanging Factor, NT (RCC1 And BTB Domain-containing Protein 2, Regulator Of Chromosome Condensation And BTB Domain-containing Protein 2, Chromosome Condensation 1-like, CHC1-L, CHC1L, RLG, RCBTB2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Anti-Palmitoyltransferase ZDHHC18 ZDHHC18 Antibody
A15025 100 µL

Anti-Palmitoyltransferase ZDHHC18 ZDHHC18 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Esrp1 shRNA (UAS) - Lentiviral mouse Esrp1 shRNA (UAS, GFP) (100)
GTR15249033 1 Vial

Lentiviral mouse Esrp1 shRNA (UAS) - Lentiviral mouse Esrp1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Mouse MSP (Macrophage Stimulating Protein) ELISA Kit
MBS8821929-01 48 Well

Mouse MSP (Macrophage Stimulating Protein) ELISA Kit

Sign In for Pricing
View Details
Mouse MSP (Macrophage Stimulating Protein) ELISA Kit
MBS8821929-02 96 Well

Mouse MSP (Macrophage Stimulating Protein) ELISA Kit

Sign In for Pricing
View Details
Mouse MSP (Macrophage Stimulating Protein) ELISA Kit
MBS8821929-03 5x 96 Well

Mouse MSP (Macrophage Stimulating Protein) ELISA Kit

Sign In for Pricing
View Details