Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUOXA2 Rabbit Polyclonal Antibody (HRP)

DUOXA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TDH5, SIMNIPHOM

UniProt

Q1HG44

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence RWFWLVRVLLSLFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARV

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RWFWLVRVLLSLFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC

NCBI Accession Number

NP_997464

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-1R1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-2594R-BF750-01 20 µL

IL-1R1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
IL-1R1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-2594R-BF750-02 100 µL

IL-1R1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
TPRX2P 3'UTR Lenti-reporter-Luc Vector
47399081 1.0 µg

TPRX2P 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Hydrogen Potassium ATPase Beta/ATP4B Rabbit Polyclonal Antibody (Fluoro647)
orb3098362 100 µg

Hydrogen Potassium ATPase Beta/ATP4B Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
3-Benzyloxycarbonylphenylboronic acid
abx185638 1 g

3-Benzyloxycarbonylphenylboronic acid

Sign In for Pricing
View Details
OTUB2, NT (OTUB2, C14orf137, OTB2, OTU2, Ubiquitin thioesterase OTUB2, Deubiquitinating enzyme OTUB2, OTU domain-containing ubiquitin aldehyde-binding protein 2, Otubain-2, Ubiquitin-specific-processing protease OTUB2) (Azide free) (HRP) discontinued
039536-HRP 200 µL

OTUB2, NT (OTUB2, C14orf137, OTB2, OTU2, Ubiquitin thioesterase OTUB2, Deubiquitinating enzyme OTUB2, OTU domain-containing ubiquitin aldehyde-binding protein 2, Otubain-2, Ubiquitin-specific-processing protease OTUB2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details