Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUOXA2 Rabbit Polyclonal Antibody (HRP)

DUOXA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TDH5, SIMNIPHOM

UniProt

Q1HG44

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence RWFWLVRVLLSLFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARV

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RWFWLVRVLLSLFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC

NCBI Accession Number

NP_997464

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant (E.Coli) Chlamydia Trachomatis W4 (191- 286 aa)
RP-1050 100 µg

Recombinant (E.Coli) Chlamydia Trachomatis W4 (191- 286 aa)

Sign In for Pricing
View Details
FNBP1 (C-9)
sc-515414 200 µg/mL

FNBP1 (C-9)

Sign In for Pricing
View Details
Olfr61 Mouse Gene Knockout Kit (CRISPR)
KN512265 1 Kit

Olfr61 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC9A7 (Sodium/Hydrogen Exchanger 7, Solute Carrier Family 9, Subfamily A (NHE7, Cation Proton Antiporter 7), Member 7)
492209 100 µL

SLC9A7 (Sodium/Hydrogen Exchanger 7, Solute Carrier Family 9, Subfamily A (NHE7, Cation Proton Antiporter 7), Member 7)

Sign In for Pricing
View Details
ZSCAN21 (Zinc Finger and SCAN Domain-containing Protein 21, Renal Carcinoma Antigen NY-REN-21, Zinc Finger Protein 38 Homolog, ZFP38, Zfp-38, ZNF38, Zipro1)
MBS6010328-01 0.1 mg

ZSCAN21 (Zinc Finger and SCAN Domain-containing Protein 21, Renal Carcinoma Antigen NY-REN-21, Zinc Finger Protein 38 Homolog, ZFP38, Zfp-38, ZNF38, Zipro1)

Sign In for Pricing
View Details
ZSCAN21 (Zinc Finger and SCAN Domain-containing Protein 21, Renal Carcinoma Antigen NY-REN-21, Zinc Finger Protein 38 Homolog, ZFP38, Zfp-38, ZNF38, Zipro1)
MBS6010328-02 5x 0.1 mg

ZSCAN21 (Zinc Finger and SCAN Domain-containing Protein 21, Renal Carcinoma Antigen NY-REN-21, Zinc Finger Protein 38 Homolog, ZFP38, Zfp-38, ZNF38, Zipro1)

Sign In for Pricing
View Details