Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBFA Rabbit Polyclonal Antibody (HRP)

RBFA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HsT169, C18orf22

UniProt

Q8N0V3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RBFA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TKKKVWYESPSLGSHSTYKPSKLEFLMRSTSKKTRKEDHARLRALNGLLY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_079081

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIM1 (Pim-1 Oncogene, OTTHUMP00000018046, Oncogene PIM1, Non-specific serine/threonine Protein Kinase, Pim-1 Kinase 44kD isoform, Pim-1 Oncogene (proviral integration site 1), PIM) (MaxLight 405) discontinued
207839-ML405 100 µL

PIM1 (Pim-1 Oncogene, OTTHUMP00000018046, Oncogene PIM1, Non-specific serine/threonine Protein Kinase, Pim-1 Kinase 44kD isoform, Pim-1 Oncogene (proviral integration site 1), PIM) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rat Transforming growth factor beta receptor type 3 (TGFBR3) ELISA Kit
MBS2804579-01 48 Tests

Rat Transforming growth factor beta receptor type 3 (TGFBR3) ELISA Kit

Sign In for Pricing
View Details
Rat Transforming growth factor beta receptor type 3 (TGFBR3) ELISA Kit
MBS2804579-02 96 Tests

Rat Transforming growth factor beta receptor type 3 (TGFBR3) ELISA Kit

Sign In for Pricing
View Details
Rat Transforming growth factor beta receptor type 3 (TGFBR3) ELISA Kit
MBS2804579-03 5x 96 Tests

Rat Transforming growth factor beta receptor type 3 (TGFBR3) ELISA Kit

Sign In for Pricing
View Details
Rat Transforming growth factor beta receptor type 3 (TGFBR3) ELISA Kit
MBS2804579-04 10x 96 Tests

Rat Transforming growth factor beta receptor type 3 (TGFBR3) ELISA Kit

Sign In for Pricing
View Details
Resistin-like Molecule, alpha (RELMa) discontinued
R1587-07A 100 µg

Resistin-like Molecule, alpha (RELMa) discontinued

Sign In for Pricing
View Details