Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD96 Rabbit Polyclonal Antibody (FITC)

CD96 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TACTILE

UniProt

P40200

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TTPQPSNSSMTTRGFNYPWTSSGTDTKKSVSRIPSETYSSSPSGAGSTLH

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human

Tested Applications

WB

NCBI Accession Number

NP_937839

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dectin 2 (Dendritic Cell-associated C-type Lectin 2, DC-associated C-type Lectin 2, Dectin-2, C-type Lectin Domain Family 6 Member A, CLEC6A, C-type Lectin Superfamily Member 10, CLECSF10) discontinued
D1876-49D1 500 µg

Dectin 2 (Dendritic Cell-associated C-type Lectin 2, DC-associated C-type Lectin 2, Dectin-2, C-type Lectin Domain Family 6 Member A, CLEC6A, C-type Lectin Superfamily Member 10, CLECSF10) discontinued

Sign In for Pricing
View Details
Rabbit Cornifin-B (SPRR1B) ELISA Kit
MBS7235696-01 48 Well

Rabbit Cornifin-B (SPRR1B) ELISA Kit

Sign In for Pricing
View Details
Rabbit Cornifin-B (SPRR1B) ELISA Kit
MBS7235696-02 96 Well

Rabbit Cornifin-B (SPRR1B) ELISA Kit

Sign In for Pricing
View Details
Rabbit Cornifin-B (SPRR1B) ELISA Kit
MBS7235696-03 5x 96 Well

Rabbit Cornifin-B (SPRR1B) ELISA Kit

Sign In for Pricing
View Details
Rabbit Cornifin-B (SPRR1B) ELISA Kit
MBS7235696-04 10x 96 Well

Rabbit Cornifin-B (SPRR1B) ELISA Kit

Sign In for Pricing
View Details
Recombinant Rickettsia felis DNA repair protein recO (recO)
MBS1312793-01 0.02 mg (E-Coli)

Recombinant Rickettsia felis DNA repair protein recO (recO)

Sign In for Pricing
View Details