Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3I Rabbit Polyclonal Antibody (FITC)

EIF3I Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TRIP1, EIF3S2, TRIP-1, PRO2242, eIF3-p36, eIF3-beta

UniProt

Q13347

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003748

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab5a Mouse mAb Antibody
orb3063688-01 50 µL

Rab5a Mouse mAb Antibody

Sign In for Pricing
View Details
Rab5a Mouse mAb Antibody
orb3063688-02 100 µL

Rab5a Mouse mAb Antibody

Sign In for Pricing
View Details
Anti-DUSP4 Rabbit pAb
GB111911-100 100 μL

Anti-DUSP4 Rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Krtap1-5 shRNA (UAS) - Lentiviral mouse Krtap1-5 shRNA (UAS, GFP) (100)
GTR15279633 1 Vial

Lentiviral mouse Krtap1-5 shRNA (UAS) - Lentiviral mouse Krtap1-5 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
TRAC Peptide
DF14496-BP 1 mg

TRAC Peptide

Sign In for Pricing
View Details
Lentiviral human SYTL4 shRNA (UAS) - Lentiviral human SYTL4 shRNA (UAS, RFP) plasmid
GTR15348340 1 Vial

Lentiviral human SYTL4 shRNA (UAS) - Lentiviral human SYTL4 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details