Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3I Rabbit Polyclonal Antibody (HRP)

EIF3I Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TRIP1, EIF3S2, TRIP-1, PRO2242, eIF3-p36, eIF3-beta

UniProt

Q13347

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003748

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Activin-A Protein
orb168660-01 2 µg

Mouse Activin-A Protein

Sign In for Pricing
View Details
Mouse Activin-A Protein
orb168660-02 10 µg

Mouse Activin-A Protein

Sign In for Pricing
View Details
Mouse Activin-A Protein
orb168660-03 1 mg

Mouse Activin-A Protein

Sign In for Pricing
View Details
LARS2 Protein Vector (Human) (pPB-N-His)
PV023382 500 ng

LARS2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
GCET2 (Germinal Center B Cell-expressed Transcript 2 Protein, Germinal Center-associated Lymphoma Protein, hGAL, GAL) (MaxLight 750) discontinued
G2023-24-ML750 100 µL

GCET2 (Germinal Center B Cell-expressed Transcript 2 Protein, Germinal Center-associated Lymphoma Protein, hGAL, GAL) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PEX14 Antibody
orb685865-01 50 μL

PEX14 Antibody

Sign In for Pricing
View Details