Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSPT1 Rabbit Polyclonal Antibody (HRP)

GSPT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GST1, ETF3A, eRF3a, 551G9.2

UniProt

P15170

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GSPT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AGGRAAPVESSQEEQSLCEGSNSAVSMELSEPIENGETEMSPEESWEHKE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001123478

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adra1a Mouse shRNA Plasmid (Locus ID 11549)
TR500051 1 Kit

Adra1a Mouse shRNA Plasmid (Locus ID 11549)

Sign In for Pricing
View Details
EMC1 Polyclonal Antibody, HRP Conjugated
bs-2279R-HRP 100 µL

EMC1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
COG3 Double Nickase Plasmid (h2)
sc-413480-NIC-2 20 µg

COG3 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Research Grade Anti-Human APP/Amyloid beta (BI 1034020)
HY235166-01 100 µg

Research Grade Anti-Human APP/Amyloid beta (BI 1034020)

Sign In for Pricing
View Details
Research Grade Anti-Human APP/Amyloid beta (BI 1034020)
HY235166-02 1 mg

Research Grade Anti-Human APP/Amyloid beta (BI 1034020)

Sign In for Pricing
View Details
OR9H1P 3'UTR GFP Stable Cell Line
TU066907 1.0 mL

OR9H1P 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details