Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUTF2 Rabbit Polyclonal Antibody (Biotin)

NUTF2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NTF2, PP15, NTF-2

UniProt

P61970

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human NUTF2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005787

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gax Rabbit Polyclonal Antibody (BF350)
orb2533754 100 µL

Gax Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Human Platelet Factor 4, PF-4 ELISA Kit
MBS703500-01 24 Well (LIMIT 1)

Human Platelet Factor 4, PF-4 ELISA Kit

Sign In for Pricing
View Details
Human Platelet Factor 4, PF-4 ELISA Kit
MBS703500-02 48 Well

Human Platelet Factor 4, PF-4 ELISA Kit

Sign In for Pricing
View Details
Human Platelet Factor 4, PF-4 ELISA Kit
MBS703500-03 96 Well

Human Platelet Factor 4, PF-4 ELISA Kit

Sign In for Pricing
View Details
Human Platelet Factor 4, PF-4 ELISA Kit
MBS703500-04 5x 96 Well

Human Platelet Factor 4, PF-4 ELISA Kit

Sign In for Pricing
View Details
Human Platelet Factor 4, PF-4 ELISA Kit
MBS703500-05 10x 96 Well

Human Platelet Factor 4, PF-4 ELISA Kit

Sign In for Pricing
View Details