Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUTF2 Rabbit Polyclonal Antibody (HRP)

NUTF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NTF2, PP15, NTF-2

UniProt

P61970

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human NUTF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005787

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GZF1, Human (sf9, His, StrepII)
HY-P701525 1 Each

GZF1, Human (sf9, His, StrepII)

Sign In for Pricing
View Details
BACE2C Antibody (C-term)
E45R11503G-1 100 µL

BACE2C Antibody (C-term)

Sign In for Pricing
View Details
ARL6IP4 (ADP-ribosylation Factor-like Protein 6-interacting Protein 4, ARL-6-interacting Protein 4, Aip-4, HSP-975, HSVI-binding Protein, SR-15, SRp25, SR-25, MGC814) (Biotin)
123536-Biotin 100 µL

ARL6IP4 (ADP-ribosylation Factor-like Protein 6-interacting Protein 4, ARL-6-interacting Protein 4, Aip-4, HSP-975, HSVI-binding Protein, SR-15, SRp25, SR-25, MGC814) (Biotin)

Sign In for Pricing
View Details
Mouse Nusap1 / Nucleolar and spindle-associated protein 1 Recombinant Protein
R0523m 1 Each

Mouse Nusap1 / Nucleolar and spindle-associated protein 1 Recombinant Protein

Sign In for Pricing
View Details
BPC 15mg+TB 15mg
BB30 10 Vials

BPC 15mg+TB 15mg

Sign In for Pricing
View Details
RGD1560927 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV644222 1.0 µg DNA

RGD1560927 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details