Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRN Rabbit Polyclonal Antibody (Biotin)

SPRN Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SHO, SHADOO, bA108K14.1

UniProt

Q5BIV9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPRN

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLAAAFLCDSGAAKGGRGGARGSARGGVRGGARGASRVRVRPAQRYGAPG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001012526

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Bromo-4- (morpholin-4-yl) quinoline-2-carboxylic acid ethyl ester
OR1076239 25 g

3-Bromo-4- (morpholin-4-yl) quinoline-2-carboxylic acid ethyl ester

Sign In for Pricing
View Details
PRS3 Antibody
orb819737 2 mg

PRS3 Antibody

Sign In for Pricing
View Details
Canine Neuromedin-S (NMS) ELISA kit
EIA06919Ca 96 Well

Canine Neuromedin-S (NMS) ELISA kit

Sign In for Pricing
View Details
ubc7 (ubiquitin Conjugating enzyme 7), 1-154 aa, Human, E Coli
MBS203071-01 0.02 mg

ubc7 (ubiquitin Conjugating enzyme 7), 1-154 aa, Human, E Coli

Sign In for Pricing
View Details
ubc7 (ubiquitin Conjugating enzyme 7), 1-154 aa, Human, E Coli
MBS203071-02 0.1 mg

ubc7 (ubiquitin Conjugating enzyme 7), 1-154 aa, Human, E Coli

Sign In for Pricing
View Details
ubc7 (ubiquitin Conjugating enzyme 7), 1-154 aa, Human, E Coli
MBS203071-03 0.5 mg

ubc7 (ubiquitin Conjugating enzyme 7), 1-154 aa, Human, E Coli

Sign In for Pricing
View Details