Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRN Rabbit Polyclonal Antibody (FITC)

SPRN Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SHO, SHADOO, bA108K14.1

UniProt

Q5BIV9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPRN

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLAAAFLCDSGAAKGGRGGARGSARGGVRGGARGASRVRVRPAQRYGAPG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001012526

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat ATP synthase subunit f, mitochondrial (Atp5j2)
orb2935897-01 20 µg

Recombinant Rat ATP synthase subunit f, mitochondrial (Atp5j2)

Sign In for Pricing
View Details
Recombinant Rat ATP synthase subunit f, mitochondrial (Atp5j2)
orb2935897-02 100 µg

Recombinant Rat ATP synthase subunit f, mitochondrial (Atp5j2)

Sign In for Pricing
View Details
Rabbit Polyclonal Niemann-Pick type C1 Like-1 Antibody [Alexa Fluor 647]
NBP2-89182AF647 0.1 mL

Rabbit Polyclonal Niemann-Pick type C1 Like-1 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Monoclonal Basigin / Emmprin / CD147 Antibody (clone 10E10), Clone: 10E10
APG02194G 0.05ml

Monoclonal Basigin / Emmprin / CD147 Antibody (clone 10E10), Clone: 10E10

Sign In for Pricing
View Details
EIF2 alpha subunit 1 (Phospho-Ser52) Antibody FITC Conjugated
orb1542176 100 µL

EIF2 alpha subunit 1 (Phospho-Ser52) Antibody FITC Conjugated

Sign In for Pricing
View Details
LOXL3 Rabbit Polyclonal Antibody (Cy5)
orb954003 100 µL

LOXL3 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details