Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATL1 Rabbit Polyclonal Antibody (HRP)

ATL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FSP1, GBP3, SPG3, HSN1D, SPG3A, AD-FSP, atlastin1

UniProt

Q8WXF7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ATL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DQVAAALWDQGSTNEALYKLYSAAATHRHLYHQAFPTPKSESTEQSEKKK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001121185.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Macrophage chemotactic factor ELISA Kit
MBS723673-01 48 Well

Rabbit Macrophage chemotactic factor ELISA Kit

Sign In for Pricing
View Details
Rabbit Macrophage chemotactic factor ELISA Kit
MBS723673-02 96 Well

Rabbit Macrophage chemotactic factor ELISA Kit

Sign In for Pricing
View Details
Rabbit Macrophage chemotactic factor ELISA Kit
MBS723673-03 5x 96 Well

Rabbit Macrophage chemotactic factor ELISA Kit

Sign In for Pricing
View Details
Rabbit Macrophage chemotactic factor ELISA Kit
MBS723673-04 10x 96 Well

Rabbit Macrophage chemotactic factor ELISA Kit

Sign In for Pricing
View Details
Mfsd5 Rat shRNA Lentiviral Particle (Locus ID 315329)
TL708328V 500 µL Each

Mfsd5 Rat shRNA Lentiviral Particle (Locus ID 315329)

Sign In for Pricing
View Details
VILIP1 (VSNL1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F7]
TA801896AM 100 µL

VILIP1 (VSNL1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F7]

Sign In for Pricing
View Details