Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO7 Rabbit Polyclonal Antibody (Biotin)

IPO7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Imp7, RANBP7

UniProt

O95373

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NVIQKMICEYSEEVTPIAVEMTQHLAMTFNQVIQTGPDEEGSDDKAVTAM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

119kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006382

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNL3L Polyclonal Antibody, Cy5 Conjugated
bs-13472R-Cy5 100 µL

GNL3L Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Recombinant Mouse CBFB Protein, His (Fc)-Avi-tagged
CBFB-1262M 50 µg

Recombinant Mouse CBFB Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Lentiviral human MMAB sgRNA gene knockout kit - Lentiviral human MMAB sgRNA gene knockout kit (25)
GTR15374712 1 Vial

Lentiviral human MMAB sgRNA gene knockout kit - Lentiviral human MMAB sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Rat Iftap Pre-designed siRNA Set A
SI206592A 1 Each

Rat Iftap Pre-designed siRNA Set A

Sign In for Pricing
View Details
Chicken Platelet Factor 4 (PF4) ELISA Kit
YP-W62116-01 48 Tests

Chicken Platelet Factor 4 (PF4) ELISA Kit

Sign In for Pricing
View Details
Chicken Platelet Factor 4 (PF4) ELISA Kit
YP-W62116-02 96 Tests

Chicken Platelet Factor 4 (PF4) ELISA Kit

Sign In for Pricing
View Details