Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EI24 Rabbit Polyclonal Antibody (HRP)

EI24 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EPG4, PIG8, TP53I8

UniProt

O14681

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001007278

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcap31 3'UTR Luciferase Stable Cell Line
TU201254 1.0 mL

Bcap31 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Genorise® Pure Plasmid DNA Mini Kit 500
GR101079-500 500 Preparations

Genorise® Pure Plasmid DNA Mini Kit 500

Sign In for Pricing
View Details
Mast Cell Tryptase (TPSB2) polyclonal antibody
BS76522-01 50 µL

Mast Cell Tryptase (TPSB2) polyclonal antibody

Sign In for Pricing
View Details
Mast Cell Tryptase (TPSB2) polyclonal antibody
BS76522-02 100 µL

Mast Cell Tryptase (TPSB2) polyclonal antibody

Sign In for Pricing
View Details
DHA|cis-4, 7, 10, 13, 16, 19-Docosahexaenoic acid (≥98%, Reagent grade)
ST1267-1g 1 g

DHA|cis-4, 7, 10, 13, 16, 19-Docosahexaenoic acid (≥98%, Reagent grade)

Sign In for Pricing
View Details
CTRP9, Recombinant, Human (His) (Complement C1q Tumor Necrosis Factor-related Protein 9, C1QTNF9, C1qTNF-related Protein 9) discontinued
044713 10 µg

CTRP9, Recombinant, Human (His) (Complement C1q Tumor Necrosis Factor-related Protein 9, C1QTNF9, C1qTNF-related Protein 9) discontinued

Sign In for Pricing
View Details