Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3C Rabbit Polyclonal Antibody (Biotin)

EIF3C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EIF3CL, EIF3S8, eIF3-p110

UniProt

H3BRV0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human EIF3C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NEMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEED

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001032897.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLAA Rabbit Polyclonal Antibody (HRP)
orb3104482 100 µg

PLAA Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Gastric Inhibitory Polypeptide (GIP)
MBS2167563-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Gastric Inhibitory Polypeptide (GIP)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Gastric Inhibitory Polypeptide (GIP)
MBS2167563-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Gastric Inhibitory Polypeptide (GIP)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Gastric Inhibitory Polypeptide (GIP)
MBS2167563-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Gastric Inhibitory Polypeptide (GIP)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Gastric Inhibitory Polypeptide (GIP)
MBS2167563-04 1 mL

Biotin-Linked Monoclonal Antibody to Gastric Inhibitory Polypeptide (GIP)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Gastric Inhibitory Polypeptide (GIP)
MBS2167563-05 5 mL

Biotin-Linked Monoclonal Antibody to Gastric Inhibitory Polypeptide (GIP)

Sign In for Pricing
View Details