Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L2HGDH Rabbit Polyclonal Antibody (Biotin)

L2HGDH Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L2HGA, C14orf160

UniProt

Q9H9P8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human L2HGDH

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_079160

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMO2, SUMO3, ID (SUMO2/3, Small Ubiquitin-like Modifier 2, Small Ubiquitin-related Modifier 2, Sumo 2, Sumo-2, Small Ubiquitin-like Modifier Protein 3, Small Ubiquitin-related Modifier 3, Sumo 3, Sumo-3, HSMT3, MGC117191, Sentrin 2, Sentrin-2, SMT3 Homolog 1, SMT3 (yeast) Homolog 1, SMT3H1, SMT3 Suppressor of Mif Two 3 Homolog 2, Suppressor of Mif Two 3 Homolog 2, SMT3 Homolog 2, SMT3 (yeast) Homolog 2, SMT3H2, SMT3 Suppressor of Mif Two 3 Homolog 3, Suppressor of Mif Two 3 Homolog 3, SMT3A, SMT3B, Ubiquitin-like Protein SMT3A, Ubiquitin-like Protein SMT3B) (Azide free) (HRP) discontinued
S8026-01C-HRP 200 µL

SUMO2, SUMO3, ID (SUMO2/3, Small Ubiquitin-like Modifier 2, Small Ubiquitin-related Modifier 2, Sumo 2, Sumo-2, Small Ubiquitin-like Modifier Protein 3, Small Ubiquitin-related Modifier 3, Sumo 3, Sumo-3, HSMT3, MGC117191, Sentrin 2, Sentrin-2, SMT3 Homolog 1, SMT3 (yeast) Homolog 1, SMT3H1, SMT3 Suppressor of Mif Two 3 Homolog 2, Suppressor of Mif Two 3 Homolog 2, SMT3 Homolog 2, SMT3 (yeast) Homolog 2, SMT3H2, SMT3 Suppressor of Mif Two 3 Homolog 3, Suppressor of Mif Two 3 Homolog 3, SMT3A, SMT3B, Ubiquitin-like Protein SMT3A, Ubiquitin-like Protein SMT3B) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal B7-H3/CD276 Antibody (185504) [DyLight 650]
FAB1027W 0.1 mL

Mouse Monoclonal B7-H3/CD276 Antibody (185504) [DyLight 650]

Sign In for Pricing
View Details
Calcium-activated Chloride channel regulator family member 3 (CLCA3) Human ELISA Kit
C0482 96 Tests

Calcium-activated Chloride channel regulator family member 3 (CLCA3) Human ELISA Kit

Sign In for Pricing
View Details
APOL4 (Center E273) Rabbit pAb
MBS8554746-01 0.1 mL

APOL4 (Center E273) Rabbit pAb

Sign In for Pricing
View Details
APOL4 (Center E273) Rabbit pAb
MBS8554746-02 0.1 mL (AF405L)

APOL4 (Center E273) Rabbit pAb

Sign In for Pricing
View Details
APOL4 (Center E273) Rabbit pAb
MBS8554746-03 0.1 mL (AF405S)

APOL4 (Center E273) Rabbit pAb

Sign In for Pricing
View Details