Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5E Rabbit Polyclonal Antibody (HRP)

NT5E Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NT, eN, NT5, NTE, eNT, CD73, E5NT, CALJA

UniProt

P21589

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCRVP

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002517

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Comb for 25 samples, 0.75 mm thick
CGMX25-0.75 1 Unit

Comb for 25 samples, 0.75 mm thick

Sign In for Pricing
View Details
Ammonium, ((p-diethylmethylammonio) phenethyl) diethylmethyl-, diiodide
orb1986555-01 25 mg

Ammonium, ((p-diethylmethylammonio) phenethyl) diethylmethyl-, diiodide

Sign In for Pricing
View Details
Ammonium, ((p-diethylmethylammonio) phenethyl) diethylmethyl-, diiodide
orb1986555-02 50 mg

Ammonium, ((p-diethylmethylammonio) phenethyl) diethylmethyl-, diiodide

Sign In for Pricing
View Details
Ammonium, ((p-diethylmethylammonio) phenethyl) diethylmethyl-, diiodide
orb1986555-03 100 mg

Ammonium, ((p-diethylmethylammonio) phenethyl) diethylmethyl-, diiodide

Sign In for Pricing
View Details
HTRA2 Rabbit Polyclonal Antibody (APC)
orb2584429 100 µg

HTRA2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Phf8 Mouse Gene Knockout Kit (CRISPR)
KN513215 1 Kit

Phf8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details