Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGFRN Rabbit Polyclonal Antibody (Biotin)

PTGFRN Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FPRP, CD315, EWI-F, CD9P-1, SMAP-6

UniProt

Q9P2B2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SWYYRMNRRSDNVVTSELLAVMDGDWTLKYGERSKQRAQDGDFIFSKEHT

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065173

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-HSP90B (Ser254) Antibody
E18-3126-2 100 µg -100 µL

Phospho-HSP90B (Ser254) Antibody

Sign In for Pricing
View Details
Large Neutral Amino Acid Transporter 1 (LAT1) Human ELISA Kit
E5975 96 Tests

Large Neutral Amino Acid Transporter 1 (LAT1) Human ELISA Kit

Sign In for Pricing
View Details
Tubulin, alpha, acetylated (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) (APC)
T9154-10-APC 100 µL

Tubulin, alpha, acetylated (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) (APC)

Sign In for Pricing
View Details
Human Glutathione Oxidized (GSSH) ELISA Kit
MBS3801601-01 48 Well

Human Glutathione Oxidized (GSSH) ELISA Kit

Sign In for Pricing
View Details
Human Glutathione Oxidized (GSSH) ELISA Kit
MBS3801601-02 96 Well

Human Glutathione Oxidized (GSSH) ELISA Kit

Sign In for Pricing
View Details
Human Glutathione Oxidized (GSSH) ELISA Kit
MBS3801601-03 5x 96 Well

Human Glutathione Oxidized (GSSH) ELISA Kit

Sign In for Pricing
View Details