Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGFRN Rabbit Polyclonal Antibody (Biotin)

PTGFRN Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FPRP, CD315, EWI-F, CD9P-1, SMAP-6

UniProt

Q9P2B2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SWYYRMNRRSDNVVTSELLAVMDGDWTLKYGERSKQRAQDGDFIFSKEHT

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065173

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FATE1 (Fetal and Adult Testis Expressed 1, FATE) (MaxLight 405) discontinued
245993-ML405 100 µL

FATE1 (Fetal and Adult Testis Expressed 1, FATE) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PYGO2 antibody - N-terminal region
MBS3210265-01 0.1 mL

PYGO2 antibody - N-terminal region

Sign In for Pricing
View Details
PYGO2 antibody - N-terminal region
MBS3210265-02 5x 0.1 mL

PYGO2 antibody - N-terminal region

Sign In for Pricing
View Details
CSTF2T (NM_015235) Human Over-expression Lysate
LS023283-100ug 100 µg

CSTF2T (NM_015235) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Monoclonal Oval Cell Marker Antibody (OC2-1D11) [DyLight 680]
NBP1-18963FR 0.1 mL

Rat Monoclonal Oval Cell Marker Antibody (OC2-1D11) [DyLight 680]

Sign In for Pricing
View Details
6H05 (TFA)
orb1299917-01 1 mg

6H05 (TFA)

Sign In for Pricing
View Details