Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGFRN Rabbit Polyclonal Antibody (FITC)

PTGFRN Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FPRP, CD315, EWI-F, CD9P-1, SMAP-6

UniProt

Q9P2B2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SWYYRMNRRSDNVVTSELLAVMDGDWTLKYGERSKQRAQDGDFIFSKEHT

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065173

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P/P059/NL425/ALU-148X210-1 Prohibited Activity Signs (No Adhesive)
240794 1 Pack (1 Panel (s) x 1 Pack)

P/P059/NL425/ALU-148X210-1 Prohibited Activity Signs (No Adhesive)

Sign In for Pricing
View Details
Ginsenoside F5
HY-108277-01 1 mg

Ginsenoside F5

Sign In for Pricing
View Details
Ginsenoside F5
HY-108277-02 5 mg

Ginsenoside F5

Sign In for Pricing
View Details
Human Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit
MBS452990-01 48 Tests

Human Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit

Sign In for Pricing
View Details
Human Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit
MBS452990-02 96 Tests

Human Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit

Sign In for Pricing
View Details
Human Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit
MBS452990-03 5x 96 Tests

Human Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit

Sign In for Pricing
View Details