Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL36 Rabbit Polyclonal Antibody (FITC)

RPL36 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L36

UniProt

Q9Y3U8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056229

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Carbohydrate Antigen 15-3, CA15-3 ELISA KIT
E0156Ca-01 48 Well

Canine Carbohydrate Antigen 15-3, CA15-3 ELISA KIT

Sign In for Pricing
View Details
Canine Carbohydrate Antigen 15-3, CA15-3 ELISA KIT
E0156Ca-02 96 Well

Canine Carbohydrate Antigen 15-3, CA15-3 ELISA KIT

Sign In for Pricing
View Details
Canine Carbohydrate Antigen 15-3, CA15-3 ELISA KIT
E0156Ca-03 5x 96 Tests

Canine Carbohydrate Antigen 15-3, CA15-3 ELISA KIT

Sign In for Pricing
View Details
Canine Carbohydrate Antigen 15-3, CA15-3 ELISA KIT
E0156Ca-04 10x 96 Tests

Canine Carbohydrate Antigen 15-3, CA15-3 ELISA KIT

Sign In for Pricing
View Details
Recombinant CSFV NS4A Protein, N-His-SUMO
YVV11001 100 μg

Recombinant CSFV NS4A Protein, N-His-SUMO

Sign In for Pricing
View Details
CRSP9 (Mediator Complex Subunit 7, CRSP33, CRSP9, MGC12284) (MaxLight 550)
MBS6216404-01 0.1 mL

CRSP9 (Mediator Complex Subunit 7, CRSP33, CRSP9, MGC12284) (MaxLight 550)

Sign In for Pricing
View Details