Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNL1 Rabbit Polyclonal Antibody (FITC)

TXNL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Txl, TXNL, TRP32, TXL-1, HEL-S-114

UniProt

O43396

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTIFVQS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004777

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chloroacetic Acid 99.5% AR
00745 00500 500 g

Chloroacetic Acid 99.5% AR

Sign In for Pricing
View Details
Anti-CD74 Antibody Picoband®, Carrier-free
A01340-4-carrier-free 100 µg/Vial

Anti-CD74 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
PTCHD2 Protein Vector (Mouse) (pPM-C-HA)
PV220608 500 ng

PTCHD2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Tmprss7 3'UTR Luciferase Stable Cell Line
TU120846 1.0 mL

Tmprss7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
S Potassium nitrate
3124445 1 Each

S Potassium nitrate

Sign In for Pricing
View Details
SFRS1, CT (Splicing Factor, Arginine/Serine-rich 1, pre-mRNA-splicing Factor SF2, P33 Subunit, Alternative-splicing Factor 1, ASF-1, OK/SW-cl.3, SF2P33, SF2, ASF)
MBS630747-01 0.2 mL

SFRS1, CT (Splicing Factor, Arginine/Serine-rich 1, pre-mRNA-splicing Factor SF2, P33 Subunit, Alternative-splicing Factor 1, ASF-1, OK/SW-cl.3, SF2P33, SF2, ASF)

Sign In for Pricing
View Details