Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCZ1 Rabbit Polyclonal Antibody (HRP)

CCZ1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CCZ1A, CGI-43, C7orf28A, H_DJ1163J12.2

UniProt

P86790

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NKRMSGSEKEPQFKFIYFNHMNLAEKSTVHMRKTPSVSLTSVHPDLMKIL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056437

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endou 3'UTR GFP Stable Cell Line
TU253976 1.0 mL

Endou 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
EBPL Recombinant Protein (Rat)
RP198992 100 µg

EBPL Recombinant Protein (Rat)

Sign In for Pricing
View Details
LOC100361070 3'UTR GFP Stable Cell Line
TU257818 1.0 mL

LOC100361070 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
LRPAP1 sgRNA CRISPR Lentivector set (Human)
K1231101 3x 1.0 µg

LRPAP1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Tert-Butyl 2,6-diazaspiro[3.6]decane-2-carboxylate
BAC00912-01 50 mg

Tert-Butyl 2,6-diazaspiro[3.6]decane-2-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 2,6-diazaspiro[3.6]decane-2-carboxylate
BAC00912-02 0.5 g

Tert-Butyl 2,6-diazaspiro[3.6]decane-2-carboxylate

Sign In for Pricing
View Details