Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NMUR1 Rabbit Polyclonal Antibody (HRP)

NMUR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FM3, FM-3, GPC-R, GPR66, NMU1R, (FM-3)

UniProt

Q9HB89

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLRLRRERLLLMQEAKGRGSAAARSRYTCRLQQHDRGRRQVTKMLFVLVV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

AAC02680

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fibroblast Growth Factor 12 (FGF12) ELISA Kit
DLR-FGF12-Hu-48T 48 Tests

Human Fibroblast Growth Factor 12 (FGF12) ELISA Kit

Sign In for Pricing
View Details
SMARCAL1 Peptide - middle region
MBS3226976-01 0.1 mg

SMARCAL1 Peptide - middle region

Sign In for Pricing
View Details
SMARCAL1 Peptide - middle region
MBS3226976-02 5x 0.1 mg

SMARCAL1 Peptide - middle region

Sign In for Pricing
View Details
Human DEFB118 activation kit by CRISPRa
GA114643 1 Kit

Human DEFB118 activation kit by CRISPRa

Sign In for Pricing
View Details
Retinoblastoma 1, Phosphorylated (S795) (RB1, RB, pRb, OSRC, pp110, p105-Rb) (AP)
MBS6435505-01 0.1 mL

Retinoblastoma 1, Phosphorylated (S795) (RB1, RB, pRb, OSRC, pp110, p105-Rb) (AP)

Sign In for Pricing
View Details
Retinoblastoma 1, Phosphorylated (S795) (RB1, RB, pRb, OSRC, pp110, p105-Rb) (AP)
MBS6435505-02 5x 0.1 mL

Retinoblastoma 1, Phosphorylated (S795) (RB1, RB, pRb, OSRC, pp110, p105-Rb) (AP)

Sign In for Pricing
View Details