Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPT Rabbit Polyclonal Antibody (Biotin)

TFPT Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FB1, amida, INO80F

UniProt

P0C1Z6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DDYRASQFTIVLEDEGSQGTDAPTPGNAENEPPEKETLSPPRRTPAPPEP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_037474

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLN Human Pre-designed siRNA Set A
HY-RS13381 1 Set

SLN Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
DiagNano™ Fluorophore Labeled Gold Nanorods, diameter 10 nm, absorption max 750 nm
RFL-10-750 1 mL

DiagNano™ Fluorophore Labeled Gold Nanorods, diameter 10 nm, absorption max 750 nm

Sign In for Pricing
View Details
Txlng (NM_001290778) Mouse Tagged ORF Clone
MR229037 10 µg

Txlng (NM_001290778) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Acetyl CoA synthetase (ACSS2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H4]
TA503609AM 100 µL

Acetyl CoA synthetase (ACSS2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H4]

Sign In for Pricing
View Details
Recombinant Tropheryma whipplei ATP synthase subunit alpha (atpA), partial
MBS1339769 Inquire

Recombinant Tropheryma whipplei ATP synthase subunit alpha (atpA), partial

Sign In for Pricing
View Details
Human Diablo Homolog (DIABLO) Protein
abx653171-01 10 µg

Human Diablo Homolog (DIABLO) Protein

Sign In for Pricing
View Details