Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPT Rabbit Polyclonal Antibody (Biotin)

TFPT Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FB1, amida, INO80F

UniProt

P0C1Z6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PEPGSPAPGEGPSGRKRRRVPRDGRRAGNALTPELAPVQIKVEEDFGFEA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_037474

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAD2 (p-Ser465) Antibody Blocking Peptide
orb73214 500 µg

SMAD2 (p-Ser465) Antibody Blocking Peptide

Sign In for Pricing
View Details
MUSK (Muscle, Skeletal, Receptor Tyrosine Kinase, MGC126323, MGC126324) (MaxLight 550)
MBS6215569-01 0.1 mL

MUSK (Muscle, Skeletal, Receptor Tyrosine Kinase, MGC126323, MGC126324) (MaxLight 550)

Sign In for Pricing
View Details
MUSK (Muscle, Skeletal, Receptor Tyrosine Kinase, MGC126323, MGC126324) (MaxLight 550)
MBS6215569-02 5x 0.1 mL

MUSK (Muscle, Skeletal, Receptor Tyrosine Kinase, MGC126323, MGC126324) (MaxLight 550)

Sign In for Pricing
View Details
Human SHH (Hedgehog Homolog, Sonic) ELISA Kit
MBS8801216-01 48 Well

Human SHH (Hedgehog Homolog, Sonic) ELISA Kit

Sign In for Pricing
View Details
Human SHH (Hedgehog Homolog, Sonic) ELISA Kit
MBS8801216-02 96 Well

Human SHH (Hedgehog Homolog, Sonic) ELISA Kit

Sign In for Pricing
View Details
Human SHH (Hedgehog Homolog, Sonic) ELISA Kit
MBS8801216-03 5x 96 Well

Human SHH (Hedgehog Homolog, Sonic) ELISA Kit

Sign In for Pricing
View Details