Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB11FIP1 Rabbit Polyclonal Antibody (HRP)

RAB11FIP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RCP, NOEL1A, rab11-FIP1

UniProt

Q6WKZ4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAB11FIP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALLGLDKFLGRAEVDLRDLHRDQGRRKTQWYKLKSKPGKKDKERGEIEVD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079427

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Anti-Human CD45 Antibody[HI30]
E-AB-F1137M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD45 Antibody[HI30]
E-AB-F1137M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD45 Antibody[HI30]
E-AB-F1137M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR559121 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Recombinant PAR4 Antibody
RC-16152-01 50 μL

Recombinant PAR4 Antibody

Sign In for Pricing
View Details
Recombinant PAR4 Antibody
RC-16152-02 100 µL

Recombinant PAR4 Antibody

Sign In for Pricing
View Details