Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB11FIP1 Rabbit Polyclonal Antibody (HRP)

RAB11FIP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RCP, NOEL1A, rab11-FIP1

UniProt

Q6WKZ4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAB11FIP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALLGLDKFLGRAEVDLRDLHRDQGRRKTQWYKLKSKPGKKDKERGEIEVD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079427

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin 22 (CLDN22) (NM_001111319) Human Over-expression Lysate
LC426365 20 µg

Claudin 22 (CLDN22) (NM_001111319) Human Over-expression Lysate

Sign In for Pricing
View Details
Fluo-4, AM Ester, 10x50ug
#50018 10x 50 µg

Fluo-4, AM Ester, 10x50ug

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR560431 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Centrin 3 (CETN3) Rabbit Polyclonal Antibody
TA369952 100 µL

Centrin 3 (CETN3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Plasmid DNA MaxiPrep Kit-20p
46600 20 Preparations

Plasmid DNA MaxiPrep Kit-20p

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), 1mg/mL
BNUM1948-50 1x 50 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), 1mg/mL

Sign In for Pricing
View Details