Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL15 Rabbit Polyclonal Antibody (HRP)

RPL15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L15, EC45, DBA12, RPL10, RPLY10, RPYL10

UniProt

P61313

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002939

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

52 kDa Ro/SSA HDR Plasmid (m)
sc-423161-HDR 20 µg

52 kDa Ro/SSA HDR Plasmid (m)

Sign In for Pricing
View Details
Campylobacter fetus (C. fetus) (MaxLight 750)
MBS6256485-01 0.1 mL

Campylobacter fetus (C. fetus) (MaxLight 750)

Sign In for Pricing
View Details
Campylobacter fetus (C. fetus) (MaxLight 750)
MBS6256485-02 5x 0.1 mL

Campylobacter fetus (C. fetus) (MaxLight 750)

Sign In for Pricing
View Details
Lentiviral human MBD3 shRNA (UAS) - Lentiviral human MBD3 shRNA (UAS, RFP) plasmid
GTR15299044 1 Vial

Lentiviral human MBD3 shRNA (UAS) - Lentiviral human MBD3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Olr1567 (NM_001000043) Rat Tagged Lenti ORF Clone
RR205876L3 10 µg

Olr1567 (NM_001000043) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal Napsin A Antibody (TMU-Ad02) [mFluor Violet 500 SE]
NB110-68133MFV500 0.1 mL

Mouse Monoclonal Napsin A Antibody (TMU-Ad02) [mFluor Violet 500 SE]

Sign In for Pricing
View Details