Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFHR4 Rabbit Polyclonal Antibody (HRP)

CFHR4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FHR4, CFHL4, FHR-4

UniProt

A8K9N7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SNGEWSEPPRCIHPCIITEENMNKNNIQLKGKSDIKYYAKTGDTIEFMCK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001188480

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFkappaB-p105/p50 (Ab-893) Antibody
MBS9410557-01 0.05 mL

NFkappaB-p105/p50 (Ab-893) Antibody

Sign In for Pricing
View Details
NFkappaB-p105/p50 (Ab-893) Antibody
MBS9410557-02 0.1 mL

NFkappaB-p105/p50 (Ab-893) Antibody

Sign In for Pricing
View Details
NFkappaB-p105/p50 (Ab-893) Antibody
MBS9410557-03 5x 0.1 mL

NFkappaB-p105/p50 (Ab-893) Antibody

Sign In for Pricing
View Details
sDR5 (Death Receptor 5, CD262, HGNC:11905, KILLER, TNF-related Apoptosis-inducing Ligand Receptor 2, TRAIL Receptor 2, TRAILR2, TRAIL-R2, TRICK2, TRICK2A, TRICK2B, TRICKB, Tumor Necrosis Factor Receptor Superfamily Member 10B, TNFRSF10B, UNQ160/PRO186, ZT
MBS6404047-01 0.1 mL

sDR5 (Death Receptor 5, CD262, HGNC:11905, KILLER, TNF-related Apoptosis-inducing Ligand Receptor 2, TRAIL Receptor 2, TRAILR2, TRAIL-R2, TRICK2, TRICK2A, TRICK2B, TRICKB, Tumor Necrosis Factor Receptor Superfamily Member 10B, TNFRSF10B, UNQ160/PRO186, ZT

Sign In for Pricing
View Details
sDR5 (Death Receptor 5, CD262, HGNC:11905, KILLER, TNF-related Apoptosis-inducing Ligand Receptor 2, TRAIL Receptor 2, TRAILR2, TRAIL-R2, TRICK2, TRICK2A, TRICK2B, TRICKB, Tumor Necrosis Factor Receptor Superfamily Member 10B, TNFRSF10B, UNQ160/PRO186, ZT
MBS6404047-02 5x 0.1 mL

sDR5 (Death Receptor 5, CD262, HGNC:11905, KILLER, TNF-related Apoptosis-inducing Ligand Receptor 2, TRAIL Receptor 2, TRAILR2, TRAIL-R2, TRICK2, TRICK2A, TRICK2B, TRICKB, Tumor Necrosis Factor Receptor Superfamily Member 10B, TNFRSF10B, UNQ160/PRO186, ZT

Sign In for Pricing
View Details
NSUN2 Antibody, Biotin conjugated
MBS7107274-01 0.05 mg

NSUN2 Antibody, Biotin conjugated

Sign In for Pricing
View Details